PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36760
Common NameKK1_041213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 103aa    MW: 11929.1 Da    PI: 10.7033
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36760genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK61.61.3e-19654351
         RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51
                   ++++l dls yF+ pik+ Ak L+v+++v+K+ CR+  + RWP+Rk+ks
  C.cajan_36760  6 AKMTLGDLSDYFHIPIKETAKLLEVSTSVVKKVCRKAELYRWPQRKVKS 54
                   6899*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.959175IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.107.2E-4348IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF020422.4E-18754IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
QRERVAKMTL GDLSDYFHIP IKETAKLLEV STSVVKKVCR KAELYRWPQR KVKSNMRKIT  60
VLRRGLANPG TREKTRVEIQ RLQQEMVEYC GGLAPTGIEM LQV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136870.16e-34hypothetical protein PHAVU_009G080800g
TrEMBLA0A151R4P85e-71A0A151R4P8_CAJCA; Uncharacterized protein (Fragment)
STRINGGLYMA20G02005.17e-31(Glycine max)
STRINGGLYMA20G01991.17e-31(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-10RWP-RK domain-containing protein